missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OSR1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 221.00 - € 470.00
Especificaciones
| Antigen | OSR1 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Código de producto | Marca | Quantity | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Quantity | Precio | Cantidad y disponibilidad | |||||
|
18671012
|
Novus Biologicals
NBP2-94383-0.02ml |
0.02 mL |
€ 221.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18647612
|
Novus Biologicals
NBP2-94383-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descripción
OSR1 Polyclonal antibody specifically detects OSR1 in Human, Mouse, Rat samples. It is validated for Western BlotEspecificaciones
| OSR1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 130497 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| ODDodd-skipped (Drosophila) homolog, odd-skipped homolog, odd-skipped related 1 (Drosophila), protein odd-skipped-related 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 28-115 of human OSR1 (NP_660303.1). NGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKPEITAGGSVPALKTKP | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto