missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Osteocalcin Antibody (190125) [DyLight 755], Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals FAB1419Z
This item is not returnable.
View return policy
Description
Osteocalcin Monoclonal antibody specifically detects Osteocalcin in Human, Rat samples. It is validated for Immunohistochemistry, Flow Cytometry (Intracellular Staining), Immunocytochemistry, CyTOF
Specifications
| Osteocalcin | |
| Monoclonal | |
| DyLight 755 | |
| 50mM Sodium Borate | |
| Mouse | |
| Protein A or G purified from hybridoma culture supernatant | |
| RUO | |
| Primary | |
| Human, Rat | |
| Purified |
| Immunohistochemistry, Flow Cytometry (Intracellular Staining), Immunocytochemistry, CyTOF | |
| 190125 | |
| Immunohistochemistry, Intracellular Staining by Flow Cytometry, Immunocytochemistry, CyTOF-ready | |
| BGP, bone gamma-carboxyglutamate (gla) protein, bone gamma-carboxyglutamate (gla) protein (osteocalcin), Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, OC, OCN, osteocalcin | |
| Human Osteocalcin synthetic peptide, YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV, Accession # P02818 | |
| 0.1 mL | |
| Extracellular Matrix, Stem Cell Markers | |
| 632 | |
| Store at 4°C in the dark. | |
| IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction