missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Osteopontin/OPN Antibody (CL10686), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP3-07980-25ul
This item is not returnable.
View return policy
Description
Osteopontin/OPN Monoclonal antibody specifically detects Osteopontin/OPN in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Osteopontin/OPN | |
| Monoclonal | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol | |
| Mouse | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| CL10686 | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| BNSP, Bone sialoprotein 1, MGC110940, Nephropontin, osteopontin, secreted phosphoprotein 1bone sialoprotein I, early T-lymphocyteactivation 1), secreted phosphoprotein-1 (osteopontin, bone sialoprotein), SPP-1, SPP1/CALPHA1 fusion, Urinary stone protein, uropontin | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDAT | |
| 25 μg | |
| Apoptosis, Biologically Active Proteins, Cancer, Cellular Markers, Extracellular Matrix, Hypoxia | |
| 6696 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction