missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Osteopontin Polyclonal Antibody
Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA594926
This item is not returnable.
View return policy
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat brain tissue, mouse brain tissue, human SHG-44 whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Osteopontin is an arginine-glycine-aspartic acid (RGD)-containing glycoprotein that interacts with integrins and CD44 as major receptors. It is a multifunctional protein involved in bone mineralization, cell adhesion, cell migration, chronic inflammatory disease and transformation. Proteolytic cleavage by thrombin and matrix metalloproteinases close to the integrin-binding Arg-Gly-Asp sequence modulates the function of OPN and its integrin binding properties. Thrombin-cleaved fragments of Osteopontin are overexpressed in malignant glial tumors and provide a molecular niche with survival advantage and provide a novel substrate for plasmin and cathepsin D.
Specifications
| Osteopontin | |
| Polyclonal | |
| Unconjugated | |
| SPP1 | |
| 2AR; 2b7; 44 kDa bone phosphoprotein; Apl-1; BNSP; Bone sialoprotein 1; Bone sialoprotein 1 (BSPI/BSP1); Bsp; BSPI; Calcium oxalate crystal growth inhibitor protein; CALPHA1 fusion; Early T lymphocyte activation 1 (ETA1); early T-lymphocyte activation 1; early T-lymphocyte activation 1 protein; Eta; ETA-1; HGNC:11255; immunoglobulin alpha 1 heavy chain constant region fusion protein; MGC110940; Minopontin; nephropontin; Op; Opn; Opnl; OSP; osteopontin; osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein; osteopontin-like protein; PSEC0156; Ric; Secreted phosphoprotein 1; secreted phosphoprotein 1 (osteopontin bone sialoprotein I early T lymphocyte activation 1); secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1); Secreted phosphoprotein 1 (SPP1); secreted phosphoprotein 1 variant 6; Sialoprotein (osteopontin); SPP1; SPP-1; SPP1/CALPHA1 fusion; unnamed protein product; urinar; urinary stone protein; Uropontin | |
| Rabbit | |
| Affinity chromatography | |
| RUO | |
| 20750, 25353, 6696 | |
| -20°C | |
| Lyophilized |
| ELISA, Western Blot | |
| 500 μg/mL | |
| PBS with 5mg BSA and 0.05mg sodium azide | |
| P08721, P10451, P10923 | |
| SPP1 | |
| A synthetic peptide corresponding to a sequence at the C-terminus of human Osteopontin (281-314aa HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN). | |
| 100 μg | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction