missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OTUD6A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 466.00
Specifications
| Antigen | OTUD6A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
OTUD6A Polyclonal specifically detects OTUD6A in Human samples. It is validated for Western Blot.Specifications
| OTUD6A | |
| Polyclonal | |
| Rabbit | |
| Human | |
| DUBA2, DUBA-2, OTU domain containing 6A | |
| OTUD6A | |
| IgG | |
| 32 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_997203 | |
| 139562 | |
| Synthetic peptide directed towards the N terminal of human OTUD6A. Peptide sequence MEAEMAQKHRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRER. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title