missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OTUD7B/Cezanne/ZA20D1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 572.00
Specifications
| Antigen | OTUD7B/Cezanne/ZA20D1 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18432551
|
Novus Biologicals
NBP1-88095-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18729813
|
Novus Biologicals
NBP1-88095 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
OTUD7B/Cezanne/ZA20D1 Polyclonal specifically detects OTUD7B/Cezanne/ZA20D1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| OTUD7B/Cezanne/ZA20D1 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| cellular zinc finger NF-kappaB Cezanne, Cellular zinc finger NF-kappa-B protein, CEZANNEA20 domain containing 1, EC 3.4.19.12, OTU domain containing 7B, OTU domain-containing protein 7B, ZA20D1, Zinc finger A20 domain-containing protein 1, Zinc finger protein Cezanne | |
| OTUD7B | |
| IgG | |
| Affinity Purified | |
| Specificity of human OTUD7B/Cezanne/ZA20D1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Mucosal Immunology | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 56957 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PHQDSIPSLEPGSHSKDGLHRGALLPPPYRVADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title