missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. OXTR Antibody, Novus Biologicals™

OXTR Antibody, Novus Biologicals™

Product Code. p-200103011 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30227072 20 μL 20µL
30231095 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30227072 Supplier Novus Biologicals Supplier No. NBP33588620ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

OXTR Polyclonal antibody specifically detects OXTR in Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen OXTR
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000, ELISA
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias OT-R, oxytocin receptor
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-394 of human OXTR (NP_000907.2).,, Sequence:, WDANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGRRLGETSASKKSNSSSFVLSHRSSSQRSCSQPSTA
Purification Method Affinity purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cancer, GPCR, Neuroscience, Neurotransmission
Primary or Secondary Primary
Gene ID (Entrez) 5021
Target Species Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.