missing translation for 'onlineSavingsMsg'
Learn More
Learn More
p18INK4c/CDKN2C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-87687
This item is not returnable.
View return policy
Description
p18INK4c/CDKN2C Polyclonal antibody specifically detects p18INK4c/CDKN2C in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| p18INK4c/CDKN2C | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| CDK6 inhibitor p18, CDKN6, cyclin-dependent inhibitor, cyclin-dependent kinase 4 inhibitor C, Cyclin-dependent kinase 6 inhibitor, cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4), INK4Ccyclin-dependent kinase 6 inhibitor p18, p18, p18-INK4C, p18-INK6 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG | |
| 0.1 mL | |
| Cell Cycle and Replication | |
| 1031 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction