missing translation for 'onlineSavingsMsg'
Learn More
Learn More
p19 INK4d Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58778-25ul
This item is not returnable.
View return policy
Description
p19 INK4d Polyclonal specifically detects p19 INK4d in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| p19 INK4d | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| CDK inhibitor p19INK4d, cell cycle inhibitor, Nur77 associating protein, cyclin-dependent kinase 4 inhibitor D, cyclin-dependent kinase 4 inhibitor D p19, cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4), inhibitor of cyclin-dependent kinase 4d, INK4D, p19, p19-INK4D | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| CDKN2D | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDAR | |
| 25 μL | |
| Cell Cycle and Replication, Ovarian Carcinoma Cell Markers | |
| 1032 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction