missing translation for 'onlineSavingsMsg'
Learn More
Learn More
p23/PTGES3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85486
This item is not returnable.
View return policy
Description
p23/PTGES3 Polyclonal antibody specifically detects p23/PTGES3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| p23/PTGES3 | |
| Polyclonal | |
| Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:20 to 1:50, Immunocytochemistry/ Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:20 to 1:50 | |
| cPGESp23, Cytosolic prostaglandin E2 synthase, Hsp90 co-chaperone, P23cytosolic prostaglandin E synthase, Progesterone receptor complex p23, prostaglandin E synthase 3, prostaglandin E synthase 3 (cytosolic), TEBPEC 5.3.99.3, Telomerase-binding protein p23, unactive progesterone receptor, 23 kD | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDD | |
| 0.1 mL | |
| Membrane Trafficking and Chaperones | |
| 10728 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction