missing translation for 'onlineSavingsMsg'
Learn More
Learn More
p23/PTGES3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85486
This item is not returnable.
View return policy
Description
p23/PTGES3 Polyclonal antibody specifically detects p23/PTGES3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| p23/PTGES3 | |
| Polyclonal | |
| Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:20 to 1:50, Immunocytochemistry/ Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:20 to 1:50 | |
| cPGESp23, Cytosolic prostaglandin E2 synthase, Hsp90 co-chaperone, P23cytosolic prostaglandin E synthase, Progesterone receptor complex p23, prostaglandin E synthase 3, prostaglandin E synthase 3 (cytosolic), TEBPEC 5.3.99.3, Telomerase-binding protein p23, unactive progesterone receptor, 23 kD | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDD | |
| 0.1 mL | |
| Membrane Trafficking and Chaperones | |
| 10728 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?