missing translation for 'onlineSavingsMsg'
Learn More
Learn More
P2X5/P2RX5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35187-20ul
This item is not returnable.
View return policy
Description
P2X5/P2RX5 Polyclonal antibody specifically detects P2X5/P2RX5 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| P2X5/P2RX5 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| ATP receptor, ATP receptor subunit, ionotropic ATP receptor P2X5, LRH-1, MGC47755, P2X purinoceptor 5, P2X5lymphoid-restricted histocompatibility antigen-1, P2X5R, Purinergic receptor, purinergic receptor P2X ligand gated ion channel 5, purinergic receptor P2X, ligand-gated ion channel, 5 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 341-422 of human P2X5/P2RX5 (NP_002552.2).,, Sequence:, KKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST | |
| 20 μL | |
| Signal Transduction | |
| 5026 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction