missing translation for 'onlineSavingsMsg'
Learn More
Learn More
P311 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 433.00 - € 554.00
Specifications
| Antigen | P311 |
|---|---|
| Dilution | Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin 1:50-1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18426800
|
Novus Biologicals
NBP1-84315-25ul |
25 μL |
€ 433.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18799873
|
Novus Biologicals
NBP1-84315 |
€ 554.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
P311 Polyclonal antibody specifically detects P311 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin).Specifications
| P311 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| chromosome 5 open reading frame 13, neuronal protein 3.1, P311PTZ17D4S114, PRO1873, Protein p311 | |
| NREP | |
| IgG | |
| Affinity Purified | |
| Specificity of human P311 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 9315 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:YYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSEL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title