missing translation for 'onlineSavingsMsg'
Learn More
Learn More
p53 DINP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85108
This item is not returnable.
View return policy
Description
p53 DINP1 Polyclonal antibody specifically detects p53 DINP1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| p53 DINP1 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| DKFZp434M1317, FLJ22139, p53DINP1, P53DINP1p53-dependent damage-inducible nuclear protein 1, p53-inducible p53DINP1, SIPStress-induced protein, Teap, TP53DINP1, TP53INP1A, TP53INP1B, tumor protein p53 inducible nuclear protein 1, tumor protein p53-inducible nuclear protein 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: VEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPC | |
| 0.1 mL | |
| Apoptosis, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair | |
| 94241 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur