missing translation for 'onlineSavingsMsg'
Learn More
Learn More
p62/SQSTM1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 302.00 - € 529.00
Specifications
| Antigen | p62/SQSTM1 |
|---|---|
| Dilution | Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18648567
|
Novus Biologicals
NBP2-68875-25ul |
25 μL |
€ 302.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18668178
|
Novus Biologicals
NBP2-68875 |
100 μg |
€ 529.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
p62/SQSTM1 Polyclonal antibody specifically detects p62/SQSTM1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| p62/SQSTM1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Adaptive Immunity, Cancer, Chromatin Modifiers, Chromatin Research, DNA Methyltransferases, Epigenetics, Innate Immunity, Tumor Suppressors | |
| PBS (pH 7.2) and 40% Glycerol | |
| 8878 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| A170, Autophagy Receptor P62, DMRV, EBI3-associated protein of 60 kDa, EBI3-associated protein p60, EBIAP, FTDALS3, NADGP, ORCA, OSIL, oxidative stress induced like, p60PDB3, p62, p62B, Paget disease of bone 3, PDB3, phosphotyrosine independent ligand for the Lck SH2 domain p62, Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa, sequestosome 1, sequestosome-1, Ubiquitin-binding protein p62, ZIP3 | |
| This p62/SQSTM1 antibody was developed against a recombinant protein corresponding to amino acids: HGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSK | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title