missing translation for 'onlineSavingsMsg'
Learn More
Learn More
p73 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 302.00 - € 498.00
Specifications
| Antigen | p73 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18271971
|
Novus Biologicals
NBP2-58523 |
100 μL |
€ 498.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18691787
|
Novus Biologicals
NBP2-58523-25ul |
25 μL |
€ 302.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
p73 Polyclonal specifically detects p73 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Spezifikation
| p73 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Tumor Suppressors | |
| p53-related protein, P73p53-like transcription factor, TA p73, TAp73, tumor protein p73 | |
| TP73 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 7161 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVMAQFNLLSSTMDQMS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts