missing translation for 'onlineSavingsMsg'
Learn More

PA28 Activator alpha Subunit/PSME1 Antibody, Novus Biologicals™

Product Code. 18458730 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18458730 25 μL 25µL
18259786 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18458730 Supplier Novus Biologicals Supplier No. NBP18312125ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody has been used in 2 publications

PA28 Activator alpha Subunit/PSME1 Polyclonal specifically detects PA28 Activator alpha Subunit/PSME1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PA28 Activator alpha Subunit/PSME1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Simple Western reported by internal validation, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias 11S regulator complex alpha subunit, 11S regulator complex subunit alpha, 29-kD MCP activator subunit, IFI5111MGC8628, IGUP I-5111, Interferon gamma up-regulated I-5111 protein, interferon-gamma IEF SSP 5111, interferon-gamma-inducible protein 5111, PA28a, PA28alphaActivator of multicatalytic protease subunit 1, proteasome (prosome, macropain) activator subunit 1 (PA28 alpha), Proteasome activator 28 subunit alpha, proteasome activator complex subunit 1, proteasome activator subunit-1, REGalpha, REG-alpha
Gene Symbols PSME1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5720
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.