missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PACT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 529.00
Specifications
| Antigen | PACT |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18236492
|
Novus Biologicals
NBP2-55124 |
100 μL |
€ 529.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18684398
|
Novus Biologicals
NBP2-55124-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PACT Polyclonal specifically detects PACT in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| PACT | |
| Polyclonal | |
| Rabbit | |
| Epigenetics, microRNA | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 8575 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGWRLPEYTLSQEGGPAHKREYTTICRLESFMETGK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| DYT16interferon-inducible double stranded RNA-dependent activator, PACTPKR-associating protein X, PKR-associated protein X, protein kinase, interferon-inducible double stranded RNA dependent activator, RAXHSD14 | |
| PRKRA | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title