missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PADI4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38499
This item is not returnable.
View return policy
Description
PADI4 Polyclonal specifically detects PADI4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| PADI4 | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Q9UM07 | |
| PADI4 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GTLTQLDICSSAPEDCTSFSINASPGVVVDIAHGPPAKKKSTGSSTWPLDPGVEVTLTMKVASGSTGDQKVQISYYGPKTPPVKALLYLTGV | |
| 0.1 mL | |
| Lipid and Metabolism | |
| 23569 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| HL-60 PAD, PADI5PADI-H protein, PADPAD4, PDI4, PDI5EC 3.5.3.15, peptidyl arginine deiminase, type IV, peptidyl arginine deiminase, type V, Peptidylarginine deiminase IV, Protein-arginine deiminase type IV, protein-arginine deiminase type-4 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction