missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PAFAH2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 198.00 - € 468.00
Specifications
| Antigen | PAFAH2 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
PAFAH2 Polyclonal antibody specifically detects PAFAH2 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| PAFAH2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Endocrinology, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 5051 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| EC 3.1.1, EC 3.1.1.47, FLJ26025, HSD-PLA2, platelet-activating factor acetylhydrolase 2 (40kD), platelet-activating factor acetylhydrolase 2, 40kDa, platelet-activating factor acetylhydrolase 2, cytoplasmic, SD-PLA2, Serine-dependent phospholipase A2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 260-350 of human PAFAH2 (NP_000428.2). AWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title