missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PAIP2B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | PAIP2B |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18215922
|
Novus Biologicals
NBP2-55980 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18683288
|
Novus Biologicals
NBP2-55980-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PAIP2B Polyclonal specifically detects PAIP2B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PAIP2B | |
| Polyclonal | |
| Rabbit | |
| Human | |
| KIAA1155, PABP-Interacting Protein 2B, PAIP-2B, Poly(A) Binding Protein Interacting Protein 2B, Poly(A)-Binding Protein-Interacting Protein 2B, Polyadenylate-Binding Protein-Interacting Protein 2B | |
| PAIP2B | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 400961 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IPSRDLPQAMGQLQQQLNGLSVSEGHDSEDILSKSDLNPDA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title