missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PALB2 Polyclonal antibody specifically detects PALB2 in Human samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | PALB2 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Janelia Fluor 669 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | DKFZp667I166, DKFZp686E1054, FANCNFLJ21816, partner and localizer of BRCA2, PNCA3 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 99-198 of human PALB2 (NP_078951.2).,, Sequence:, TLDVGPESFNPGDGPGGLPIQRTDDTQEHFPHRVSDPSGEQKQKLPSRRKKQQKRTFISQERDCVFGTDSLRLSGKRLKEQEEISSKNPARSPVTEIRTH |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?