missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PALB2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38533-100ul
This item is not returnable.
View return policy
Description
PALB2 Polyclonal antibody specifically detects PALB2 in Human samples. It is validated for ELISA,Western Blot
Specifications
| PALB2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| DKFZp667I166, DKFZp686E1054, FANCNFLJ21816, partner and localizer of BRCA2, PNCA3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 99-198 of human PALB2 (NP_078951.2).,, Sequence:, TLDVGPESFNPGDGPGGLPIQRTDDTQEHFPHRVSDPSGEQKQKLPSRRKKQQKRTFISQERDCVFGTDSLRLSGKRLKEQEEISSKNPARSPVTEIRTH | |
| 100 μL | |
| Breast Cancer, Cancer | |
| 79728 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Übermitteln Sie eine inhaltliche Korrektur