missing translation for 'onlineSavingsMsg'
Learn More

Palladin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

€ 280.00 - € 572.00

Specifications

Antigen	Palladin
Applications	Western Blot, Immunocytochemistry, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18204913 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-58731	100 μL	€ 572.00 100µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18681928 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-58731-25ul	25 μL	€ 280.00 25µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

Palladin Polyclonal specifically detects Palladin in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	Palladin
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cellular Markers, Cytoskeleton Markers, Signal Transduction
Gene Alias	CGI151, CGI-151, FLJ22190, FLJ38193, KIAA0992FLJ39139, MYN, myoneurin, palladin, palladin, cytoskeletal associated protein, PNCA1, Sarcoma antigen NY-SAR-77, SIH002FLJ61376
Gene Symbols	PALLD
Isotype	IgG
Purification Method	Affinity Purified

Applications	Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene ID (Entrez)	23022
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NCSYESMGESNNDHFQHFPPPPPILETSSLELASKKPSEIQQVNNPELGLSRAALQMQFNAAERETNGVHPSRGVNGLINGKANSNKSLPTP
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

Zurück zum Seitenanfang

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

Palladin Antibody, Novus Biologicals™

Specifications

Description

Specifications

Dokumentation