missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PAQR6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57962
This item is not returnable.
View return policy
Description
PAQR6 Polyclonal specifically detects PAQR6 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| PAQR6 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| progestin and adipoQ receptor family member 6, progestin and adipoQ receptor family member VIFLJ22672 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 79957 | |
| Human | |
| IgG |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| PAQR6 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YIGEGTPGPAREEAGADAFPEHRMNWATATSYSTSVQCWAPTSSWRQCWLIWDHAEPGWPHRNLPWAWQAQWPHWSWLQL | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto