missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PARP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35672-20ul
This item is not returnable.
View return policy
Description
PARP2 Polyclonal antibody specifically detects PARP2 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| PARP2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| ADP-ribosyltransferase (NAD+; poly(ADP-ribose) polymerase)-like 2, ADPRT-2, ADPRT2pADPRT-2, ADPRTL2EC 2.4.2.30, ADPRTL3, hPARP-2, NAD(+) ADP-ribosyltransferase 2, PARP-2, poly (ADP-ribose) polymerase 2, poly (ADP-ribose) polymerase family, member 2, poly (ADP-ribosyl) transferase-like 2, poly [ADP-ribose] polymerase 2, poly(ADP-ribose) synthetase, Poly[ADP-ribose] synthase 2, poly[ADP-ribose] synthetase 2 | |
| A synthetic peptide corresponding to a sequence within amino acids 450-550 of human PARP2 (NP_001036083.1).,, Sequence:, FADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASDTGILNPDGYTLNYNEYIVYN | |
| 20 μL | |
| Apoptosis, DNA Repair, Hypoxia | |
| 10038 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction