missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PBLD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-83682-25ul
This item is not returnable.
View return policy
Description
PBLD Polyclonal specifically detects PBLD in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| PBLD | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500-1:1000 | |
| EC 5.1, FLJ14767, FLJ35507, MAWBPMAWDBPMAWD binding protein, MAWD-binding protein, phenazine biosynthesis-like domain-containing protein, phenazine biosynthesis-like protein domain containing, Unknown protein 32 from 2D-page of liver tissue | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PBLD | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LSGELRARRAEDGIVLDLPLYPAHPQDFHEVEDLIKTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLENLKVNTE | |
| 25 μL | |
| Proteases & Other Enzymes | |
| 64081 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction