missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PCBD1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93878-0.1ml
This item is not returnable.
View return policy
Description
PCBD1 Polyclonal antibody specifically detects PCBD1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| PCBD1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:10-1:100 | |
| 4-alpha-hydroxy-tetrahydropterin dehydratase, DCoH, DCOHpterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1), Dimerization cofactor of hepatocyte nuclear factor 1-alpha, Dimerization cofactor of HNF1, PCBDdimerizing cofactor for HNF1,6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1), PCDEC 4.2.1.96, Phenylalanine hydroxylase-stimulating protein, PHS, Pterin carbinolamine dehydratase, pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha, pterin-4-alpha-carbinolamine dehydratase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-104 of human PCBD1 (NP_000272.1). MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT | |
| 0.1 mL | |
| Amino Acids Drugs and other small molecules, Cancer, Endocrinology, Signal Transduction | |
| 5092 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction