missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PCDHA5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00
Specifications
| Antigen | PCDHA5 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
PCDHA5 Polyclonal specifically detects PCDHA5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PCDHA5 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 56143 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GEIKVNGELDYEDYNSYEINIDAMDKSTFPLSGHCKVVVKLLDVNDNTP | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CNR6, CNRN6, CNRS6, CRNR6, KIAA0345-like 9, ortholog of mouse CNR6, PCDH-alpha-5, PCDH-ALPHA5, protocadherin alpha 5, protocadherin alpha-5 | |
| PCDHA5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title