missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PCDHGB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 590.10
Specifications
| Antigen | PCDHGB1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18295513
|
Novus Biologicals
NBP2-56005 |
100 μL |
 € 624.00 € 590.10 / 100µL Save € 33.90 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18696627
|
Novus Biologicals
NBP2-56005-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PCDHGB1 Polyclonal specifically detects PCDHGB1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PCDHGB1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| MGC119466, MGC119467, MGC119469, PCDH-GAMMA-B1, protocadherin gamma subfamily B, 1, protocadherin gamma-B1 | |
| PCDHGB1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 56104 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('INAEITYAFLNSPISTSLFNLNPNTGDITTNGTLDFEETSRYVLSVEAKDG',) | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title