missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PDCL3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-80627
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
PDCL3 Polyclonal specifically detects PDCL3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifica
| PDCL3 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q9H2J4 | |
| PDCL3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:IGPLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD | |
| 0.1 mL | |
| Apoptosis | |
| 79031 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| HTPHLP, IAP-associated factor VIAF1, MGC3062, PHLP3, phosducin-like 3, phosducin-like protein 3, PhPL3, VIAF, VIAF-1, VIAF1PHLP2A, Viral IAP-associated factor 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto