missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PDHX Polyclonal specifically detects PDHX in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antigen | PDHX |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenasecomplex, DLDBP, E3-binding protein, E3BPpyruvate dehydrogenase complex, E3-binding protein subunit, OPDX, PDX1Lipoyl-containing pyruvate dehydrogenase complex component X, proXpyruvate dehydrogenase complex, lipoyl-containing component X, pyruvate dehydrogenase complex, component X, pyruvate dehydrogenase protein X component, mitochondrial |
| Gene Symbols | PDHX |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEI |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?