missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PDK4 Antibody - Azide and BSA Free, Novus Biologicals™

PDK4 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18614272 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18614272 0.02 mL 0.02mL
18688672 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18614272 Supplier Novus Biologicals Supplier No. NBP2951940.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

PDK4 Polyclonal antibody specifically detects PDK4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen PDK4
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial, EC 2.7.11, EC 2.7.11.2, FLJ40832, Pyruvate dehydrogenase kinase isoform 4, pyruvate dehydrogenase kinase, isoenzyme 4, pyruvate dehydrogenase kinase, isozyme 4, pyruvate dehydrogenase, lipoamide, kinase isozyme 4, mitochondrial
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 312-411 of human PDK4 (NP_002603.1). STAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDAIIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Cancer, Lipid and Metabolism, Mitochondrial Markers, Protein Kinase, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5166
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.