missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PEA-15 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 593.00
Specifications
| Antigen | PEA-15 |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18668726
|
Novus Biologicals
NBP2-62670-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18637428
|
Novus Biologicals
NBP2-62670 |
100 μg |
€ 593.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PEA-15 Polyclonal antibody specifically detects PEA-15 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| PEA-15 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cell Biology, Cellular Markers | |
| PBS (pH 7.2) and 40% Glycerol | |
| 8682 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| HMAT115kD, PEA-15, PED15 kDa phosphoprotein enriched in astrocytes, phosphoprotein enriched in astrocytes 15, Phosphoprotein enriched in diabetes | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PPWPGQTSPVMAEYGTLLQDLTNNITLEDLGQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLD | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title