missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pea3 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33399-100ul
This item is not returnable.
View return policy
Description
Pea3 Monoclonal antibody specifically detects Pea3 in Human samples. It is validated for ELISA,Western Blot
Specifications
| Pea3 | |
| Monoclonal | |
| Western Blot 1:2000 - 1:9000, ELISA Recommended starting concentration is 1 μg/mL | |
| Adenovirus E1A enhancer-binding protein, E1A-FE1A enhancer binding protein, E1AFETS translocation variant 4, ets variant 4, ets variant gene 4 (E1A enhancer binding protein, E1AF), ets variant gene 4 (E1A enhancer-binding protein, E1AF), EWS protein/E1A enhancer binding protein chimera, PEA3, PEAS3, Polyomavirus enhancer activator 3 homolog, polyomavirus enhancer activator-3, Protein PEA3 | |
| A synthetic peptide corresponding to a sequence within amino acids 384-484 of human Pea3 (NP_001977.1).,, Sequence:, QKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY | |
| 100 μL | |
| Cancer | |
| 2118 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction