missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PEBP4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 470.00
Specifications
| Antigen | PEBP4 |
|---|---|
| Dilution | Western Blot 1:500-1:1000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18652232
|
Novus Biologicals
NBP2-94404-0.02ml |
0.02 mL |
€ 190.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18624792
|
Novus Biologicals
NBP2-94404-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PEBP4 Polyclonal antibody specifically detects PEBP4 in Mouse samples. It is validated for Western BlotSpecifications
| PEBP4 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| CORK-1, CORK1GWTM1933, cousin-of-RKIP 1 protein, hPEBP4PRO4408, MGC22776, PEBP-4, PEPB4, phosphatidylethanolamine-binding protein 4, Protein cousin-of-RKIP 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 23-120 of human PEBP4 (NP_659399.2). DEDENSPCAHEALLDEDTLFCQGLEVFYPELGNIGCKVVPDCNNYRQKITSWMEPIVKFPGAVDGATYILVMVDPDAPSRAEPRQRFWRHWLVTDIKG | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500-1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 157310 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title