missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pentraxin 3/TSG-14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49595
This item is not returnable.
View return policy
Description
Pentraxin 3/TSG-14 Polyclonal antibody specifically detects Pentraxin 3/TSG-14 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Pentraxin 3/TSG-14 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| alpha-induced protein 5, pentaxin-related gene, rapidly induced by IL-1 beta, tumor necrosis factor, Pentaxin-related protein PTX3, pentraxin 3, long, pentraxin-3, pentraxin-related gene, rapidly induced by IL-1 beta, pentraxin-related protein PTX3, TNF alpha-induced protein 5, TNFAIP5, TSG14, TSG-14pentaxin-related gene, rapidly induced by IL-1 beta, Tumor necrosis factor alpha-induced protein 5, tumor necrosis factor, alpha-induced protein 5, Tumor necrosis factor-inducible gene 14 protein, tumor necrosis factor-inducible protein TSG-14 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS | |
| 0.1 mL | |
| Immunology | |
| 5806 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction