missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PGM1 Antibody (CL3301), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-59026-25ul
This item is not returnable.
View return policy
Beskrivning
PGM1 Monoclonal specifically detects PGM1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifikationer
| PGM1 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| EC 5.4.2, EC 5.4.2.2, Glucose phosphomutase 1, GSD14, PGM 1, phosphoglucomutase 1, phosphoglucomutase-1 | |
| Mouse | |
| Protein A purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG1 |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide | |
| PGM1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SILATRKQSVEDILKDHWQKHGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSD | |
| 25 μL | |
| Lipid and Metabolism | |
| 5236 | |
| Human | |
| Purified |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering