missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PHF22 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 484.00
Specifications
| Antigen | PHF22 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PHF22 Polyclonal specifically detects PHF22 in Human samples. It is validated for Western Blot.Specifications
| PHF22 | |
| Polyclonal | |
| Rabbit | |
| NP_065128 | |
| 57117 | |
| Synthetic peptide directed towards the N terminal of human INTS12. Peptide sequence DESLARGIDSSYRPSQKDVEPPKISSTKNISIKQEPKISSSLPSGNNNGK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Int12, integrator complex subunit 12, PHD finger protein 22INT12, PHF22, SBBI22 | |
| INTS12 | |
| IgG | |
| 49 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title