missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PHOSPHO2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 470.00
Specifications
| Antigen | PHOSPHO2 |
|---|---|
| Dilution | Western Blot 1:500-1:1000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18681691
|
Novus Biologicals
NBP2-93287-0.02ml |
0.02 mL |
€ 190.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18691351
|
Novus Biologicals
NBP2-93287-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PHOSPHO2 Polyclonal antibody specifically detects PHOSPHO2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| PHOSPHO2 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 493911 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:1000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| phosphatase, orphan 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PHOSPHO2 (NP_001008489.1). MKILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGRVFKYLGDKGVREHEMKRAVTSLPFTPGMVELFNFIRKNKDKFDCIIISDS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title