missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Phospholemman Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 193.00 - € 483.00
Specifications
| Antigen | Phospholemman |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18636412
|
Novus Biologicals
NBP2-95165-0.02ml |
0.02 mL |
€ 193.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18668152
|
Novus Biologicals
NBP2-95165-0.1ml |
0.1 mL |
€ 483.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Phospholemman Polyclonal antibody specifically detects Phospholemman in Mouse, Rat samples. It is validated for Western BlotSpecifications
| Phospholemman | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 5348 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| FXYD domain containing ion transport regulator 1, FXYD domain-containing ion transport regulator 1, MGC44983, PLMphospholemman | |
| A synthetic peptide corresponding to a sequence within amino acids 1-92 of human FXYD1 (NP_005022.2). MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title