missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PIGU Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35867-20ul
This item is not returnable.
View return policy
Description
PIGU Polyclonal antibody specifically detects PIGU in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Specifications
| PIGU | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| bA346K17.2, CDC91 (cell division cycle 91, S. cerevisiae, homolog)-like 1, CDC91L1CDC91 cell division cycle 91-like 1 (S. cerevisiae), cell division cycle 91-like 1 protein, Cell division cycle protein 91-like 1, GAB1, GPI transamidase component PIG-U, GPI transamidase subunit, MGC40420, phosphatidylinositol glycan anchor biosynthesis class U protein, phosphatidylinositol glycan anchor biosynthesis, class U, Protein CDC91-like 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PIGU (NP_536724.1).,, Sequence:, MAAPLVLVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPLIIYLFHFLIDYAELVFMITDALTAIALYFAIQ | |
| 20 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 128869 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto