missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PILR-beta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-62359
This item is not returnable.
View return policy
Description
PILR-beta Polyclonal antibody specifically detects PILR-beta in Human samples. It is validated for Western Blot
Specifications
| PILR-beta | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose | |
| activating receptor PILRbeta, Activating receptor PILR-beta, Cell surface receptor FDFACT, cell surface receptor FDFACT1, cell surface receptor FDFACT2, FDFACT, FDFACT1, FDFACT2, paired immunoglobin-like receptor beta, paired immunoglobin-like type 2 receptor beta, paired immunoglobulin-like receptor beta, paired immunoglobulin-like type 2 receptor beta | |
| Synthetic peptides corresponding to PILRB(paired immunoglobin-like type 2 receptor beta) The peptide sequence was selected form the middle region of PILRB. Peptide sequence KLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALA. The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μg | |
| Signal Transduction | |
| 29990 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| 0.5 mg/mL | |
| Western Blot 1.0 μg/mL | |
| Q9UKJ0 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction