missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PIM3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93244-0.02ml
This item is not returnable.
View return policy
Description
PIM3 Polyclonal antibody specifically detects PIM3 in Human samples. It is validated for Western Blot
Specifications
| PIM3 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| EC 2.7.11.1, pim-3, pim-3 oncogene, serine/threonine kinase Pim-3, serine/threonine-protein kinase pim-3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 247-326 of human PIM3 (NP_001001852.2). QDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGVPESCDLRLCTLDPDDVASTTSSSESL | |
| 0.02 mL | |
| Protein Kinase | |
| 415116 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction