missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PINX1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 486.00 - € 679.00
Specifications
| Antigen | PINX1 |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18350807
|
Novus Biologicals
NBP3-17911-25UL |
25 μg |
€ 486.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18354075
|
Novus Biologicals
NBP3-17911-100UL |
100 μg |
€ 679.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PINX1 Polyclonal antibody specifically detects PINX1 in Human samples. It is validated for ImmunofluorescenceSpecifications
| PINX1 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cancer | |
| PBS, pH 7.2, 40% glycerol | |
| 54984 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| FLJ20565, hepatocellular carcinoma-related putative tumor suppressor, Liver-related putative tumor suppressor, LPTLPinX1, LPTS67-11-3 protein, MGC8850, PIN2 interacting protein 1, PIN2/TERF1 interacting, telomerase inhibitor 1, PIN2/TERF1-interacting telomerase inhibitor 1, PIN2-interacting protein 1, Pin2-interacting protein X1, Protein 67-11-3, TRF1-interacting protein 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: ENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERKRGKKRNKEATGKDVESYLQP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title