missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PIP5K2 alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | PIP5K2 alpha |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18266282
|
Novus Biologicals
NBP2-56952 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18604697
|
Novus Biologicals
NBP2-56952-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PIP5K2 alpha Polyclonal specifically detects PIP5K2 alpha in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PIP5K2 alpha | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 1-phosphatidylinositol-4-phosphate kinase, 1-phosphatidylinositol-4-phosphate-5-kinase, 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha, Diphosphoinositide kinase 2-alpha, EC 2.7.1, EC 2.7.1.149, FLJ13267, phosphatidylinositol-4-phosphate 5-kinase, type II, alpha, Phosphatidylinositol-5-phosphate 4-kinase type II alpha, phosphatidylinositol-5-phosphate 4-kinase type-2 alpha, phosphatidylinositol-5-phosphate 4-kinase, type II, alpha, PI(5)P 4-kinase type II alpha, PIP4KII-alpha, PIP5K2, PIP5K2API5P4KA, PIP5KIIA, PIP5KIIalpha, PIP5KII-alpha, PIP5KIII, PIPK, PtdIns(4)P-5-kinase B isoform, PtdIns(4)P-5-kinase C isoform, PtdIns(5)P-4-kinase isoform 2-alpha, type II phosphatidylinositol-4-phosphate 5-kinase 53 K isoform | |
| PIP4K2A | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5305 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title