missing translation for 'onlineSavingsMsg'
Learn More

PKC theta Antibody, Novus Biologicals™

Product Code. 18621037 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18621037 25 μL 25µL
18671698 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18621037 Supplier Novus Biologicals Supplier No. NBP25571725ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

PKC theta Polyclonal antibody specifically detects PKC theta in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen PKC theta
Applications Western Blot, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot -Reported in scientific literature (PMID:34073294), Immunocytochemistry/ Immunofluorescence 0.25-2 μg/ml
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias EC 2.7.11, EC 2.7.11.13, MGC126514, MGC141919, nPKC-theta, PRKCT, protein kinase C theta type, protein kinase C, theta
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQK
Purification Method Affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Protein Kinase, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5588
Target Species Human, Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.