missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PLEKHA3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-32018
This item is not returnable.
View return policy
Description
PLEKHA3 Polyclonal specifically detects PLEKHA3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| PLEKHA3 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q9HB20 | |
| PLEKHA3 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FAPP-1, FAPP1PH domain-containing family A member 3, FLJ20067, four-phosphate-adaptor protein 1, Phosphatidylinositol-four-phosphate adapter protein 1, Phosphoinositol 4-phosphate adapter protein 1, pleckstrin homology domain containing, family A (phosphoinositide bindingspecific) member 3, pleckstrin homology domain-containing family A member 3, pleckstrin homology domain-containing, family A (phosphoinositide bindingspecific) member 3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 65977 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction