missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Plexin A4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
€ 292.00 - € 564.00
Specifications
| Antigen | Plexin A4 |
|---|---|
| Dilution | Western Blot, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18402132
|
Novus Biologicals
NBP1-85128-25ul |
25ul |
€ 292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18720724
|
Novus Biologicals
NBP1-85128 |
0.1 mL |
€ 564.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Plexin A4 Polyclonal specifically detects Plexin A4 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Plexin A4 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 91584 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SHVKVAGVECSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLKPSRGPMSGGTQVTI | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse | |
| A, DKFZp434G0625, FAYV2820, FLJ35026, FLJ38287, KIAA1550DKFZp566O0546, plexin A4, plexin A4, B, plexin-A4, PLXNA4A, PLXNA4B, PRO34003 | |
| PLXNA4 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title