missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PLGRKT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 483.00
Specifications
| Antigen | C9orf46 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PLGRKT Polyclonal specifically detects PLGRKT in Human samples. It is validated for Western Blot.Specifications
| C9orf46 | |
| Polyclonal | |
| Rabbit | |
| B2R6W0 | |
| 55848 | |
| Synthetic peptides corresponding to C9ORF46 The peptide sequence was selected from the middle region of C9ORF46. Peptide sequence AIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| AD025, C9orf46, chromosome 9 open reading frame 46,5033414D02Rik, FLJ14688, FLJ39176, MDS030, plasminogen receptor, C-terminal lysine transmembrane protein, Plg-R(KT), PLG-RKT, transmembrane protein C9orf46 | |
| PLGRKT | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title