missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PLOD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
Brand: Novus Biologicals NBP2-38770
This item is not returnable.
View return policy
Description
PLOD1 Polyclonal specifically detects PLOD1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry-Paraffin.
Specifications
| PLOD1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry-Paraffin | |
| Q02809 | |
| PLOD1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: FVSLFFQRLLRLHYPQKHMRLFIHNHEQHHKAQVEEFLAQHGSEYQSVKLVGPEVRMANADARN | |
| 0.1 mL | |
| Primary | |
| PLOD1 antibody verified on Human Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 2-oxoglutarate 5-dioxygenase 1, EC 1.14.11.4, Ehlers-Danlos syndrome type VI), FLJ42041, LH1, LLH, lysine hydroxylase, Lysyl hydroxylase 1, PLODLH, procollagen-lysine, procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase (lysine hydroxylase, procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1, procollagen-lysine, 2-oxoglutarate 5-dioxygenase | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 5351 | |
| Human, Mouse | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction